General Information

    • DRAMP ID

    • DRAMP04414

    • Peptide Name

    • Defensin 1 (Def1)

    • Source

    • Triatoma brasiliensis (Blood-sucking bug)

    • Family

    • Not found

    • Gene

    • def1

    • Sequence

    • ATCDLFSFESKWFTPNHAACAAHCILLGNRGGHCVGTVCHCRK

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04414 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C201H306N62O55S6

    • Absent Amino Acids

    • MQY

    • Common Amino Acids

    • C

    • Mass

    • 4663.38

    • PI

    • 8.36

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +6

    • Boman Index

    • -43.38

    • Hydrophobicity

    • 0.123

    • Aliphatic Index

    • 61.4

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 139.88

    • Polar Residues

    • 17

DRAMP04414

DRAMP04414 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two novel defensin-encoding genes of the Chagas disease vector Triatoma brasiliensis (Reduviidae, Triatominae): gene expression and peptide-structure modeling.

    • Reference

    • J Insect Physiol. 2009 Sep;55(9):840-848.

    • Author

    • Waniek PJ, Castro HC, Sathler PC, Miceli L, Jansen AM, Araújo CA.