• DRAMP ID

    • DRAMP04417
    • Peptide Name

    • Defensin 4 (Def4)
    • Source

    • Triatoma brasiliensis (Blood-sucking bug)
    • Family

    • Not found
    • Gene

    • def4
    • Sequence

    • ATCDLFSFQSKWVTPNHAACAAHCLLRGNRGGQCKGTICHCRK
    • Sequence Length

    • 43
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04417 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04417.
    • Formula

    • C198H314N66O55S6
    • Absent Amino Acids

    • EMY
    • Common Amino Acids

    • C
    • Mass

    • 4691.44
    • PI

    • 9.18
    • Basic Residues

    • 9
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +8
    • Boman Index

    • -70.48
    • Hydrophobicity

    • -0.242
    • Aliphatic Index

    • 54.65
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 139.88
    • Polar Residues

    • 17

DRAMP04417

DRAMP04417 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Two novel defensin-encoding genes of the Chagas disease vector Triatoma brasiliensis (Reduviidae, Triatominae): gene expression and peptide-structure modeling.
    • Reference

    • J Insect Physiol. 2009 Sep;55(9):840-848.
    • Author

    • Waniek PJ, Castro HC, Sathler PC, Miceli L, Jansen AM, Araújo CA.