General Information

    • DRAMP ID

    • DRAMP04424

    • Peptide Name

    • BacA protein

    • Source

    • Enterococcus faecalis (Streptococcus faecalis)

    • Family

    • Not found

    • Gene

    • bacA

    • Sequence

    • ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGNVQHGPWAPR

    • Sequence Length

    • 43

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04424 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04424.

Physicochemical Information

    • Formula

    • C222H333N65O60S2

    • Absent Amino Acids

    • FM

    • Common Amino Acids

    • GN

    • Mass

    • 4936.61

    • PI

    • 9.45

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -71.42

    • Hydrophobicity

    • -0.751

    • Aliphatic Index

    • 63.49

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 502.26

    • Polar Residues

    • 17

DRAMP04424

DRAMP04424 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cloning and genetic organization of the bacteriocin 31 determinant encoded on the Enterococcus faecalis pheromone-responsive conjugative plasmid pYI17.

    • Reference

    • J Bacteriol. 1996 Jun;178(12):3585-3593.

    • Author

    • Tomita H, Fujimoto S, Tanimoto K, Ike Y.