General Information

    • DRAMP ID

    • DRAMP04425

    • Peptide Name

    • Termicin

    • Source

    • Drepanotermes rubriceps

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DCNTKACWALCQREHGIYFRRAVCEGSRCKCILVNGR

    • Sequence Length

    • 37

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04425 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04425.

Physicochemical Information

    • Formula

    • C178H288N60O50S6

    • Absent Amino Acids

    • MP

    • Common Amino Acids

    • C

    • Mass

    • 4260.98

    • PI

    • 8.94

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -88.63

    • Hydrophobicity

    • -0.303

    • Aliphatic Index

    • 65.95

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 204.58

    • Polar Residues

    • 14

DRAMP04425

DRAMP04425 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Duplication and diversifying selection among termite antifungal peptides.

    • Reference

    • Mol Biol Evol. 2004 Dec;21(12):2256-2264.

    • Author

    • Bulmer MS, Crozier RH.