• DRAMP ID

    • DRAMP04426
    • Peptide Name

    • Defensin C
    • Source

    • Rhodnius prolixus (Triatomid bug)
    • Family

    • Not found
    • Gene

    • DEFC
    • Sequence

    • MKCILSLFTLFLVATLVYSYPAEWNSQHQLDDAQWEPAGELTEEHLSRMKRATCDLLSLTSKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCRK
    • Sequence Length

    • 94
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04426 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04426.
    • Formula

    • C467H722N132O132S9
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • L
    • Mass

    • 10586.22
    • PI

    • 7.62
    • Basic Residues

    • 14
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 33
    • Net Charge

    • +6
    • Boman Index

    • -117.79
    • Hydrophobicity

    • -0.075
    • Aliphatic Index

    • 78.94
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19855
    • Absorbance 280nm

    • 213.49
    • Polar Residues

    • 31

DRAMP04426

DRAMP04426 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation and characterization of a novel insect defensin from Rhodnius prolixus, a vector of Chagas disease.
    • Reference

    • Insect Biochem Mol Biol. 2003 Apr;33(4):439-447.
    • Author

    • Lopez L, Morales G, Ursic R, Wolff M, Lowenberger C.