General Information

    • DRAMP ID

    • DRAMP04426

    • Peptide Name

    • Defensin C

    • Source

    • Rhodnius prolixus (Triatomid bug)

    • Family

    • Not found

    • Gene

    • DEFC

    • Sequence

    • MKCILSLFTLFLVATLVYSYPAEWNSQHQLDDAQWEPAGELTEEHLSRMKRATCDLLSLTSKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCRK

    • Sequence Length

    • 94

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04426 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C467H722N132O132S9

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • L

    • Mass

    • 10586.22

    • PI

    • 7.62

    • Basic Residues

    • 14

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 33

    • Net Charge

    • +6

    • Boman Index

    • -117.79

    • Hydrophobicity

    • -0.075

    • Aliphatic Index

    • 78.94

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19855

    • Absorbance 280nm

    • 213.49

    • Polar Residues

    • 31

DRAMP04426

DRAMP04426 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of a novel insect defensin from Rhodnius prolixus, a vector of Chagas disease.

    • Reference

    • Insect Biochem Mol Biol. 2003 Apr;33(4):439-447.

    • Author

    • Lopez L, Morales G, Ursic R, Wolff M, Lowenberger C.