• DRAMP ID

    • DRAMP04427
    • Peptide Name

    • Beta defensin-2
    • Source

    • Capra hircus (Goat)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
    • Sequence Length

    • 38
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04427 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04427.
    • Formula

    • C176H298N68O46S7
    • Absent Amino Acids

    • DEFLW
    • Common Amino Acids

    • CR
    • Mass

    • 4327.15
    • PI

    • 10.25
    • Basic Residues

    • 12
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +12
    • Boman Index

    • -123.14
    • Hydrophobicity

    • -1.053
    • Aliphatic Index

    • 30.79
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 50.41
    • Polar Residues

    • 15

DRAMP04427

DRAMP04427 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Differential expression of caprine beta-defensins in digestive and respiratory tissues.
    • Reference

    • Infect Immun. 1999 Nov;67(11):6221-6224.
    • Author

    • Zhao C, Nguyen T, Liu L, Shamova O, Brogden K, Lehrer RI.