General Information

    • DRAMP ID

    • DRAMP04430

    • Peptide Name

    • Putative potassium channel blocker TXKs2

    • Source

    • Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DKYCSENPLDCNEHCLKTKNQIGICHGANGNEKCSCMES

    • Sequence Length

    • 39

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04430 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04430.

Physicochemical Information

    • Formula

    • C172H275N53O63S7

    • Absent Amino Acids

    • FRVW

    • Common Amino Acids

    • C

    • Mass

    • 4317.81

    • PI

    • 5.44

    • Basic Residues

    • 6

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 5

    • Net Charge

    • 0

    • Boman Index

    • -93.51

    • Hydrophobicity

    • -0.921

    • Aliphatic Index

    • 42.56

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 49.08

    • Polar Residues

    • 19

DRAMP04430

DRAMP04430 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Evidence for the existence of insect defensin-like peptide in scorpion venom.

    • Reference

    • IUBMB Life. 2000 Jul;50(1):57-61.

    • Author

    • Zhu S, Li W, Jiang D, Zeng X.