• DRAMP ID

    • DRAMP04431
    • Peptide Name

    • Precursor of durancin TW-49M (Prepeptide of durancin TW-49M)
    • Source

    • Enterococcus durans
    • Family

    • Not found
    • Gene

    • durM
    • Sequence

    • ENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM
    • Sequence Length

    • 54
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04431 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04431.
    • Formula

    • C223H362N68O69S4
    • Absent Amino Acids

    • QTW
    • Common Amino Acids

    • G
    • Mass

    • 5227.98
    • PI

    • 8.13
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +2
    • Boman Index

    • -22.27
    • Hydrophobicity

    • 0.128
    • Aliphatic Index

    • 81.48
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 30.47
    • Polar Residues

    • 23

DRAMP04431

DRAMP04431 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Characterization of durancin TW-49M and its atypical genetic locus: a novel bacteriocin produced by carrot-isolated Enterococcus durans QU 49.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hu C, Zendo T, Nakayama J, Sonomoto K.