General Information

    • DRAMP ID

    • DRAMP04431

    • Peptide Name

    • Precursor of durancin TW-49M (Prepeptide of durancin TW-49M)

    • Source

    • Enterococcus durans

    • Family

    • Not found

    • Gene

    • durM

    • Sequence

    • ENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM

    • Sequence Length

    • 54

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04431 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C223H362N68O69S4

    • Absent Amino Acids

    • QTW

    • Common Amino Acids

    • G

    • Mass

    • 5227.98

    • PI

    • 8.13

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +2

    • Boman Index

    • -22.27

    • Hydrophobicity

    • 0.128

    • Aliphatic Index

    • 81.48

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 30.47

    • Polar Residues

    • 23

DRAMP04431

DRAMP04431 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization of durancin TW-49M and its atypical genetic locus: a novel bacteriocin produced by carrot-isolated Enterococcus durans QU 49.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hu C, Zendo T, Nakayama J, Sonomoto K.