General Information

    • DRAMP ID

    • DRAMP04435

    • Peptide Name

    • Defensin domain protein

    • Source

    • Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSCA1100) (Aspergillus fumigatus)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FCHNSISCMMGGDSTCNNVCVRQGNPNGGRCLPRDGCPGYDICACYPNN

    • Sequence Length

    • 49

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04435 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C208H322N68O70S10

    • Absent Amino Acids

    • EKW

    • Common Amino Acids

    • C

    • Mass

    • 5215.86

    • PI

    • 6.69

    • Basic Residues

    • 4

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +1

    • Boman Index

    • -91.5

    • Hydrophobicity

    • -0.418

    • Aliphatic Index

    • 37.76

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 72.5

    • Polar Residues

    • 28

DRAMP04435

DRAMP04435 chydropathy plot

Comments Information

    • Caution

    • The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data.

Literature Information

  • ·Literature 1

    • Title

    • Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus.

    • Reference

    • Nature. 2005 Dec 22;438(7071):1151-6.

    • Author

    • Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, et al.