• DRAMP ID

    • DRAMP04435
    • Peptide Name

    • Defensin domain protein
    • Source

    • Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSCA1100) (Aspergillus fumigatus)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • FCHNSISCMMGGDSTCNNVCVRQGNPNGGRCLPRDGCPGYDICACYPNN
    • Sequence Length

    • 49
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04435 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04435.
    • Formula

    • C208H322N68O70S10
    • Absent Amino Acids

    • EKW
    • Common Amino Acids

    • C
    • Mass

    • 5215.86
    • PI

    • 6.69
    • Basic Residues

    • 4
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +1
    • Boman Index

    • -91.5
    • Hydrophobicity

    • -0.418
    • Aliphatic Index

    • 37.76
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 72.5
    • Polar Residues

    • 28

DRAMP04435

DRAMP04435 chydropathy plot
    • Caution

    • The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data.
  • ·Literature 1
    • Title

    • Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus.
    • Reference

    • Nature. 2005 Dec 22;438(7071):1151-6.
    • Author

    • Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, et al.