• DRAMP ID

    • DRAMP04438
    • Peptide Name

    • Non-specific lipid-transfer protein
    • Source

    • Oryza sativa subsp. indica (Rice)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • Not found
    • Sequence

    • ITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVR
    • Sequence Length

    • 92
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04438 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04438.
    • Formula

    • C376H639N127O122S8
    • Absent Amino Acids

    • EFHMW
    • Common Amino Acids

    • A
    • Mass

    • 9147.47
    • PI

    • 9.75
    • Basic Residues

    • 12
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 30
    • Net Charge

    • +10
    • Boman Index

    • -137.83
    • Hydrophobicity

    • 0.013
    • Aliphatic Index

    • 73.37
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 38.24
    • Polar Residues

    • 43

DRAMP04438

DRAMP04438 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • ·Literature 1
    • Title

    • The Genomes of Oryza sativa: A History of Duplications.
    • Reference

    • PLoS Biol. 2005 Feb;3(2):e38.
    • Author

    • Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, et al.