• DRAMP ID

    • DRAMP04439
    • Peptide Name

    • Defensin-like protein (Putative defensin; Predicted)
    • Source

    • Bombyx mori (Silk moth)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • IWCEFEEATETAICQEHCLPKGYSYGICVSNTCSCI
    • Sequence Length

    • 36
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04439 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04439.
    • Formula

    • C173H260N42O57S6
    • Absent Amino Acids

    • DMR
    • Common Amino Acids

    • C
    • Mass

    • 4032.57
    • PI

    • 4.32
    • Basic Residues

    • 2
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 10
    • Net Charge

    • -3
    • Boman Index

    • -27.5
    • Hydrophobicity

    • 0.15
    • Aliphatic Index

    • 67.78
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 253
    • Polar Residues

    • 17

DRAMP04439

DRAMP04439 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Defensin-like protein encoding cysteine-rich peptides in immune response of silkworm Bombyx mori.
    • Reference

    • Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    • Author

    • Kang SJ, Park KS, Park BR.