General Information

    • DRAMP ID

    • DRAMP04443

    • Peptide Name

    • Thionin Asthi4

    • Source

    • Avena sativa (Oat)

    • Family

    • Not found

    • Gene

    • Asthi4

    • Sequence

    • KSCCKSTTAINCYNVCRLAGAPRPVCAGPCGCKLLDVTTCPSDWPK

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04443 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04443.

Physicochemical Information

    • Formula

    • C203H333N59O61S8

    • Absent Amino Acids

    • EFHMQ

    • Common Amino Acids

    • C

    • Mass

    • 4832.72

    • PI

    • 8.73

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -48.95

    • Hydrophobicity

    • 0.011

    • Aliphatic Index

    • 61.52

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 166.44

    • Polar Residues

    • 21

DRAMP04443

DRAMP04443 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Enhanced resistance to seed-transmitted bacterial diseases in transgenic rice plants overproducing an oat cell-wall-bound thionin.

    • Reference

    • Mol Plant Microbe Interact. 2002 Jun;15(6):515-521.

    • Author

    • Iwai T, Kaku H, Honkura R, Nakamura S, Ochiai H, Sasaki T, Ohashi Y.