General Information

    • DRAMP ID

    • DRAMP04445

    • Peptide Name

    • Lipid binding protein

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MALALRFFICFVLTVCIVSSVDAEISCGTVVSNLAPCANYLSKGGVVPDLCCEGVEKLNGVAQTMPMPTVHCKGHFWSQPKSSLWSS

    • Sequence Length

    • 87

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04445 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C412H649N105O118S10

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • VS

    • Mass

    • 9281.92

    • PI

    • 6.68

    • Basic Residues

    • 7

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 34

    • Net Charge

    • +2

    • Boman Index

    • -12.08

    • Hydrophobicity

    • 0.569

    • Aliphatic Index

    • 92.87

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 149.59

    • Polar Residues

    • 31

DRAMP04445

DRAMP04445 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Small cysteine-rich peptides resembling antimicrobial peptides have been under-predicted in plants.

    • Reference

    • Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Silverstein K.A.T, Moskal W.A.Jr, Wu H.C, Underwood B.A, Graham M.A, Town C.D, VandenBosch K.A.