• DRAMP ID

    • DRAMP04447
    • Peptide Name

    • Defensin
    • Source

    • Picea glauca (White spruce) (Pinus glauca)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MADKGVCSRLSALFLLVLLVISIGMMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP
    • Sequence Length

    • 83
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04447 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04447.
    • Formula

    • C381H623N107O113S12
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • CSL
    • Mass

    • 8895.51
    • PI

    • 8.81
    • Basic Residues

    • 11
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 26
    • Net Charge

    • +6
    • Boman Index

    • -81.8
    • Hydrophobicity

    • 0.155
    • Aliphatic Index

    • 75.18
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 24.27
    • Polar Residues

    • 32

DRAMP04447

DRAMP04447 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A spruce defensin showing strong antifungal activity and increased transcript accumulation after wounding and jasmonate treatments.
    • Reference

    • Physiol. Mol. Plant Pathol. 2004, 64:331-341.
    • Author

    • Pervieux I, Bourassa M, Laurans F, Hamelin R, Seguin A.