• DRAMP ID

    • DRAMP04449
    • Peptide Name

    • Gamma-thionin 1
    • Source

    • Eutrema japonica (Wasabi plant) (Eutrema wasabi)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MAKFASIIALLFAALVLFSAFEAPSMVEAQKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
    • Sequence Length

    • 80
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04449 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04449.
    • Formula

    • C389H593N103O108S10
    • Absent Amino Acids

    • D
    • Common Amino Acids

    • A
    • Mass

    • 8761.21
    • PI

    • 8.15
    • Basic Residues

    • 8
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 31
    • Net Charge

    • +4
    • Boman Index

    • -42.12
    • Hydrophobicity

    • 0.32
    • Aliphatic Index

    • 77
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10470
    • Absorbance 280nm

    • 132.53
    • Polar Residues

    • 30

DRAMP04449

DRAMP04449 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Production of antimicrobial defensin in Nicotiana benthamiana with a potato virus X vector.
    • Reference

    • Mol Plant Microbe Interact. 2001 Feb;14(2):111-115.
    • Author

    • Saitoh H, Kiba A, Nishihara M, Yamamura S, Suzuki K, Terauchi R.