General Information

    • DRAMP ID

    • DRAMP04449

    • Peptide Name

    • Gamma-thionin 1

    • Source

    • Eutrema japonica (Wasabi plant) (Eutrema wasabi)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MAKFASIIALLFAALVLFSAFEAPSMVEAQKLCEKSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC

    • Sequence Length

    • 80

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04449 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04449.

Physicochemical Information

    • Formula

    • C389H593N103O108S10

    • Absent Amino Acids

    • D

    • Common Amino Acids

    • A

    • Mass

    • 8761.21

    • PI

    • 8.15

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +4

    • Boman Index

    • -42.12

    • Hydrophobicity

    • 0.32

    • Aliphatic Index

    • 77

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 132.53

    • Polar Residues

    • 30

DRAMP04449

DRAMP04449 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Production of antimicrobial defensin in Nicotiana benthamiana with a potato virus X vector.

    • Reference

    • Mol Plant Microbe Interact. 2001 Feb;14(2):111-115.

    • Author

    • Saitoh H, Kiba A, Nishihara M, Yamamura S, Suzuki K, Terauchi R.