General Information

    • DRAMP ID

    • DRAMP04450

    • Peptide Name

    • Defensin

    • Source

    • Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassicapekinensis)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MAKFVSIITLLFAALVLFAAFDAPTMVKAQKLCERSSGTWSGVCGNNNACKNQRINLEGARHGSCNYVFP

    • Sequence Length

    • 70

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04450 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C336H530N94O94S6

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • A

    • Mass

    • 7582.84

    • PI

    • 9.16

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 29

    • Net Charge

    • +5

    • Boman Index

    • -57.21

    • Hydrophobicity

    • 0.243

    • Aliphatic Index

    • 83.71

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 104.93

    • Polar Residues

    • 24

DRAMP04450

DRAMP04450 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization of ethylene-inducible genes in Chinese cabbage.

    • Reference

    • Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases

    • Author

    • Park YS, Cho TJ.