• DRAMP ID

    • DRAMP04450
    • Peptide Name

    • Defensin
    • Source

    • Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassicapekinensis)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MAKFVSIITLLFAALVLFAAFDAPTMVKAQKLCERSSGTWSGVCGNNNACKNQRINLEGARHGSCNYVFP
    • Sequence Length

    • 70
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04450 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04450.
    • Formula

    • C336H530N94O94S6
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • A
    • Mass

    • 7582.84
    • PI

    • 9.16
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 29
    • Net Charge

    • +5
    • Boman Index

    • -57.21
    • Hydrophobicity

    • 0.243
    • Aliphatic Index

    • 83.71
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7240
    • Absorbance 280nm

    • 104.93
    • Polar Residues

    • 24

DRAMP04450

DRAMP04450 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Characterization of ethylene-inducible genes in Chinese cabbage.
    • Reference

    • Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
    • Author

    • Park YS, Cho TJ.