• DRAMP ID

    • DRAMP04453
    • Peptide Name

    • Defensin protein 1
    • Source

    • Amblyomma hebraeum (bont tick)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MATVRNSRPEAAGEPSGVSSTEGDWRHIEKRDVSYQGEGNTRRFDNPFGCPADEGKCFDHCNNKAYDIGYCGGSYRATCVCYRK
    • Sequence Length

    • 84
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04453 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04453.
    • Formula

    • C393H595N123O130S7
    • Absent Amino Acids

    • L
    • Common Amino Acids

    • G
    • Mass

    • 9347.21
    • PI

    • 6.7
    • Basic Residues

    • 14
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +2
    • Boman Index

    • -246.62
    • Hydrophobicity

    • -1.006
    • Aliphatic Index

    • 30.24
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 13325
    • Absorbance 280nm

    • 160.54
    • Polar Residues

    • 36

DRAMP04453

DRAMP04453 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Two Novel Anionic Defensin-like antimicrobial proteins from Hemolymph of the Female Tick, Amblyomma hebraeum.
    • Reference

    • Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
    • Author

    • Lai R, Turner PC, Lomas LO, Jonczy J, Rees HH.