General Information

    • DRAMP ID

    • DRAMP04455

    • Peptide Name

    • Antifungal protein defensin

    • Source

    • Arachis diogoi

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MEKKSLAGLCFLFLVLFVAQEIVVTEAKTCENLADKYRGPCFSGCDTHCTTKEHAVSGRCRDDFRCWCTKRC

    • Sequence Length

    • 72

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04455 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04455.

Physicochemical Information

    • Formula

    • C353H558N100O103S10

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • C

    • Mass

    • 8171.52

    • PI

    • 8.1

    • Basic Residues

    • 13

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +4

    • Boman Index

    • -125.54

    • Hydrophobicity

    • -0.099

    • Aliphatic Index

    • 65

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 105.49

    • Polar Residues

    • 24

DRAMP04455

DRAMP04455 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • RT-PCR based cloning of defensin cDNA from Arachis chacoense.

    • Reference

    • Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases

    • Author

    • Olli S, Kirthi PB.