General Information

    • DRAMP ID

    • DRAMP04457

    • Peptide Name

    • PDF1

    • Source

    • Vigna radiata (Mung bean)

    • Family

    • Not found

    • Gene

    • pDF1

    • Sequence

    • MEKKSLAGLCFLFLVLFVAQEVMVQTEAKTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC

    • Sequence Length

    • 75

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04457 helical wheel diagram
  • 2GL1-> 

    • Predicted Structure

Physicochemical Information

    • Formula

    • C367H579N109O110S11

    • Absent Amino Acids

    • I

    • Common Amino Acids

    • C

    • Mass

    • 8630.96

    • PI

    • 8.1

    • Basic Residues

    • 13

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 21

    • Net Charge

    • +4

    • Boman Index

    • -163.87

    • Hydrophobicity

    • -0.353

    • Aliphatic Index

    • 57.2

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 101.22

    • Polar Residues

    • 27

DRAMP04457

DRAMP04457 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Structure-based protein engineering for alpha-amylase inhibitory activity of plant defensin.

    • Reference

    • Proteins. 2007 Aug 1;68(2):530-540.

    • Author

    • Lin KF, Lee TR, Tsai PH, Hsu MP, Chen CS, Lyu PC.