General Information

    • DRAMP ID

    • DRAMP04459

    • Peptide Name

    • Defensin 1

    • Source

    • Acalolepta luxuriosa (Udo longhorn beetle)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MKFFITFTFVLSLVVLTVYSAPREFAEPEEQDEGHFRVKRFTCDVLSVEAKGVKLNHAACGIHCLFRRRTGGYCNKKRVCICR

    • Sequence Length

    • 83

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04459 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04459.

Physicochemical Information

    • Formula

    • C429H676N122O113S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • VFR

    • Mass

    • 9575.26

    • PI

    • 9.24

    • Basic Residues

    • 17

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +9

    • Boman Index

    • -138.83

    • Hydrophobicity

    • 0.015

    • Aliphatic Index

    • 79.76

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 40.91

    • Polar Residues

    • 23

DRAMP04459

DRAMP04459 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and cDNA cloning of an insect defensin from larvae of the longicorn beetle, Acalolepta luxuriosa.

    • Reference

    • Appl. Entomol. Zool. (Jpn.) 2005, 40:335-345.

    • Author

    • Ueda K, Imamura M, Saito A, Sato R.