General Information

    • DRAMP ID

    • DRAMP04460

    • Peptide Name

    • Defensin 2a

    • Source

    • Stomoxys calcitrans (Stable fly) (Conops calcitrans)

    • Family

    • Not found

    • Gene

    • smd2a

    • Sequence

    • MKFFSLFPVILVVVACLTMRANAAPSAGDEVDHHPDYVDGVEALRQLEPELHGRYKRATCDLLSMWNVNHSACAAHCLLLGKSGGRCNDDAVCVCRK

    • Sequence Length

    • 97

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04460 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C461H731N135O134S10

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • ALV

    • Mass

    • 10629.3

    • PI

    • 6.48

    • Basic Residues

    • 15

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 37

    • Net Charge

    • +4

    • Boman Index

    • -125.55

    • Hydrophobicity

    • 0.076

    • Aliphatic Index

    • 89.48

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 92.24

    • Polar Residues

    • 26

DRAMP04460

DRAMP04460 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Expression and regulation of the genes, smd1 and smd2, which encode midgut-specific defensin molecules in Stomoxys calcitrans.

    • Reference

    • Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases

    • Author

    • Munks R.J.L, Lehane S.M, Lehane M.J.