• DRAMP ID

    • DRAMP04461
    • Peptide Name

    • Defensin 1a
    • Source

    • Stomoxys calcitrans (Stable fly) (Conops calcitrans)
    • Family

    • Not found
    • Gene

    • smd1a
    • Sequence

    • MKFLNVVAIALLVVACLSVYSNAAPHEGVKEVAAAKPMGITCDLLSLWKVGHAACAAHCLVLGNVGGYCTKEGLCVCKE
    • Sequence Length

    • 79
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04461 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04461.
    • Formula

    • C363H591N95O100S9
    • Absent Amino Acids

    • QR
    • Common Amino Acids

    • AV
    • Mass

    • 8174.8
    • PI

    • 7.58
    • Basic Residues

    • 9
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 37
    • Net Charge

    • +4
    • Boman Index

    • 31.97
    • Hydrophobicity

    • 0.818
    • Aliphatic Index

    • 114.81
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 113.53
    • Polar Residues

    • 24

DRAMP04461

DRAMP04461 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Expression and regulation of the genes, smd1 and smd2, which encode midgut-specific defensin molecules in Stomoxys calcitrans.
    • Reference

    • Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    • Author

    • Munks R.J.L, Lehane S.M, Lehane M.J.