• DRAMP ID

    • DRAMP04462
    • Peptide Name

    • Putative uncharacterized protein
    • Source

    • Culicoides sonorensis
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MKFLQIFVLIATLWIAIVTANPVDDQKTAEIQENSNLIDETNNDEVIIQPRLSCQALGPIGCAANCKRLGFRGGWCTTGNTCRCFR
    • Sequence Length

    • 86
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04462 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04462.
    • Formula

    • C416H668N118O124S7
    • Absent Amino Acids

    • HY
    • Common Amino Acids

    • I
    • Mass

    • 9531.02
    • PI

    • 6.11
    • Basic Residues

    • 8
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 33
    • Net Charge

    • 0
    • Boman Index

    • -112.54
    • Hydrophobicity

    • 0.057
    • Aliphatic Index

    • 94.19
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11375
    • Absorbance 280nm

    • 133.82
    • Polar Residues

    • 28

DRAMP04462

DRAMP04462 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Midgut and salivary gland transcriptomes of the arbovirus vector Culicoides sonorensis (Diptera: Ceratopogonidae).
    • Reference

    • Insect Mol. Biol. 2005, 0:0-0.
    • Author

    • Campbell C.L, VanDyke K.A, Letchworth G.J, Drolet B.S, Hanekamp T, Wilson W.C.