General Information

    • DRAMP ID

    • DRAMP04462

    • Peptide Name

    • Putative uncharacterized protein

    • Source

    • Culicoides sonorensis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MKFLQIFVLIATLWIAIVTANPVDDQKTAEIQENSNLIDETNNDEVIIQPRLSCQALGPIGCAANCKRLGFRGGWCTTGNTCRCFR

    • Sequence Length

    • 86

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04462 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C416H668N118O124S7

    • Absent Amino Acids

    • HY

    • Common Amino Acids

    • I

    • Mass

    • 9531.02

    • PI

    • 6.11

    • Basic Residues

    • 8

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 33

    • Net Charge

    • 0

    • Boman Index

    • -112.54

    • Hydrophobicity

    • 0.057

    • Aliphatic Index

    • 94.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11375

    • Absorbance 280nm

    • 133.82

    • Polar Residues

    • 28

DRAMP04462

DRAMP04462 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Midgut and salivary gland transcriptomes of the arbovirus vector Culicoides sonorensis (Diptera: Ceratopogonidae).

    • Reference

    • Insect Mol. Biol. 2005, 0:0-0.

    • Author

    • Campbell C.L, VanDyke K.A, Letchworth G.J, Drolet B.S, Hanekamp T, Wilson W.C.