• DRAMP ID

    • DRAMP04463
    • Peptide Name

    • Enterocin 1071A (Enterocin EntC1 peptide)
    • Source

    • Enterococcus faecalis (Streptococcus faecalis)
    • Family

    • Not found
    • Gene

    • ent1071A
    • Sequence

    • MKQYKVLNEKEMKKPIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
    • Sequence Length

    • 57
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04463 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04463.
    • Formula

    • C283H462N82O80S3
    • Absent Amino Acids

    • CT
    • Common Amino Acids

    • K
    • Mass

    • 6389.46
    • PI

    • 9.92
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +7
    • Boman Index

    • -101.24
    • Hydrophobicity

    • -0.683
    • Aliphatic Index

    • 75.26
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 151.43
    • Polar Residues

    • 16

DRAMP04463

DRAMP04463 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Characterization and cloning of the genes encoding enterocin 1071A and enterocin 1071B, two antimicrobial peptides produced by Enterococcus faecalis BFE 1071.
    • Reference

    • Appl Environ Microbiol. 2000 Apr;66(4):1298-1304.
    • Author

    • Balla E, Dicks LM, Du Toit M, Van Der Merwe MJ, Holzapfel WH.