General Information

    • DRAMP ID

    • DRAMP04463

    • Peptide Name

    • Enterocin 1071A (Enterocin EntC1 peptide)

    • Source

    • Enterococcus faecalis (Streptococcus faecalis)

    • Family

    • Not found

    • Gene

    • ent1071A

    • Sequence

    • MKQYKVLNEKEMKKPIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH

    • Sequence Length

    • 57

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04463 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C283H462N82O80S3

    • Absent Amino Acids

    • CT

    • Common Amino Acids

    • K

    • Mass

    • 6389.46

    • PI

    • 9.92

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +7

    • Boman Index

    • -101.24

    • Hydrophobicity

    • -0.683

    • Aliphatic Index

    • 75.26

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 151.43

    • Polar Residues

    • 16

DRAMP04463

DRAMP04463 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and cloning of the genes encoding enterocin 1071A and enterocin 1071B, two antimicrobial peptides produced by Enterococcus faecalis BFE 1071.

    • Reference

    • Appl Environ Microbiol. 2000 Apr;66(4):1298-1304.

    • Author

    • Balla E, Dicks LM, Du Toit M, Van Der Merwe MJ, Holzapfel WH.