General Information

    • DRAMP ID

    • DRAMP04464

    • Peptide Name

    • Hepcidin 1

    • Source

    • Epinephelus coioides (Orange-spotted grouper) (Epinephelus nebulosus)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MKTFSVAVAVAIVLAFICTQESSALPVTGVEELVELVSSDDPVADHQELPVELGERLFNIRKKRASPKCTPYCYPTRDGV

    • Sequence Length

    • 80

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04464 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C388H625N101O119S4

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • V

    • Mass

    • 8737.08

    • PI

    • 4.97

    • Basic Residues

    • 9

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 31

    • Net Charge

    • -2

    • Boman Index

    • -96.08

    • Hydrophobicity

    • 0.115

    • Aliphatic Index

    • 97.38

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3105

    • Absorbance 280nm

    • 39.3

    • Polar Residues

    • 20

DRAMP04464

DRAMP04464 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and characterization of two novel hepcidins from orange-spotted grouper, Epinephelus coioides.

    • Reference

    • Fish Shellfish Immunol. 2011 Feb;30(2):559-568.

    • Author

    • Zhou J.G, Wei J.G, Xu D, Cui H.C, Yan Y, Ou-Yang Z.L, Huang X.H, Huang Y.H, Qin Q.W.