General Information

    • DRAMP ID

    • DRAMP04467

    • Peptide Name

    • Columbicin A

    • Source

    • Enterococcus columbae

    • Family

    • Not found

    • Gene

    • colA

    • Sequence

    • MMNATENQIFVETVSDQELEMLIGGAGRGWIKTLTKDCPNVISSICAGTIITACKNCA

    • Sequence Length

    • 58

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04467 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C263H435N71O86S7

    • Absent Amino Acids

    • HY

    • Common Amino Acids

    • IT

    • Mass

    • 6192.19

    • PI

    • 4.66

    • Basic Residues

    • 4

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 20

    • Net Charge

    • -2

    • Boman Index

    • -46.96

    • Hydrophobicity

    • 0.236

    • Aliphatic Index

    • 90.86

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 100.88

    • Polar Residues

    • 22

DRAMP04467

DRAMP04467 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Amino acid and nucleotide sequence of columbicin A, a novel lantibiotic variant produced by Enterococcus columbae PLCH2, isolated from wood pigeons (Columba palumbus).

    • Reference

    • Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Martin M, Brede D.A, Herranz C, Nes I.F, Cintas L.M, Hernandez P.E.