General Information

    • DRAMP ID

    • DRAMP04468

    • Peptide Name

    • Defensin I

    • Source

    • Mayetiola destructor (Hessian fly)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MNFKLLNLFAMVLFGVVVISNAAKPPSGFLTPDADNDENGNGVEEQTLERFTCDIWQNQAACAIHCIANGFRGGYCNAQKVCVCRR

    • Sequence Length

    • 86

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04468 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C411H639N117O122S8

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • AN

    • Mass

    • 9427.79

    • PI

    • 5.63

    • Basic Residues

    • 8

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 33

    • Net Charge

    • 0

    • Boman Index

    • -106.74

    • Hydrophobicity

    • 0.024

    • Aliphatic Index

    • 79.42

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 86.65

    • Polar Residues

    • 28

DRAMP04468

DRAMP04468 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Expression patterns of antibacterial genes in the Hessian fly.

    • Reference

    • J Insect Physiol. 2006 Nov-Dec;52(11-12):1143-1152.

    • Author

    • Mittapalli O, Shukle RH, Sardesai N, Giovanini MP, Williams CE.