General Information

    • DRAMP ID

    • DRAMP04469

    • Peptide Name

    • Cecropin (Cecropin 1 (Cecropin A)

    • Source

    • Musca domestica (House fly)

    • Family

    • Not found

    • Gene

    • Cep 1

    • Sequence

    • MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG

    • Sequence Length

    • 63

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04469 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C304H502N86O83S2

    • Absent Amino Acids

    • PY

    • Common Amino Acids

    • A

    • Mass

    • 6753.98

    • PI

    • 10.02

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +6

    • Boman Index

    • -37.13

    • Hydrophobicity

    • 0.3

    • Aliphatic Index

    • 108.41

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 88.71

    • Polar Residues

    • 15

DRAMP04469

DRAMP04469 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and recombinant expression of a new gene encoding an antimicrobial peptide from house fly.

    • Reference

    • Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases

    • Author

    • Wang J, Zhao X.