• DRAMP ID

    • DRAMP04469
    • Peptide Name

    • Cecropin (Cecropin 1 (Cecropin A)
    • Source

    • Musca domestica (House fly)
    • Family

    • Not found
    • Gene

    • Cep 1
    • Sequence

    • MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG
    • Sequence Length

    • 63
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04469 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04469.
    • Formula

    • C304H502N86O83S2
    • Absent Amino Acids

    • PY
    • Common Amino Acids

    • A
    • Mass

    • 6753.98
    • PI

    • 10.02
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 30
    • Net Charge

    • +6
    • Boman Index

    • -37.13
    • Hydrophobicity

    • 0.3
    • Aliphatic Index

    • 108.41
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 88.71
    • Polar Residues

    • 15

DRAMP04469

DRAMP04469 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Molecular cloning and recombinant expression of a new gene encoding an antimicrobial peptide from house fly.
    • Reference

    • Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
    • Author

    • Wang J, Zhao X.