General Information

    • DRAMP ID

    • DRAMP04470

    • Peptide Name

    • Plantaricin NC8 beta peptide

    • Source

    • Lactobacillus plantarum

    • Family

    • Not found

    • Gene

    • plnc8B

    • Sequence

    • MNNLNKFSTLGKSSLSQIEGGSVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH

    • Sequence Length

    • 55

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04470 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04470.

Physicochemical Information

    • Formula

    • C283H443N75O80S

    • Absent Amino Acids

    • CD

    • Common Amino Acids

    • SK

    • Mass

    • 6208.14

    • PI

    • 10

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +8

    • Boman Index

    • -74.22

    • Hydrophobicity

    • -0.415

    • Aliphatic Index

    • 76.18

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 184.63

    • Polar Residues

    • 24

DRAMP04470

DRAMP04470 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and genetic characterization of plantaricin NC8, a novel coculture-inducible two-peptide bacteriocin from Lactobacillus plantarum NC8.

    • Reference

    • Appl Environ Microbiol. 2003 Jan;69(1):383-389.

    • Author

    • Maldonado A, Ruiz-Barba JL, Jiménez-Díaz R.