• DRAMP ID

    • DRAMP04470
    • Peptide Name

    • Plantaricin NC8 beta peptide
    • Source

    • Lactobacillus plantarum
    • Family

    • Not found
    • Gene

    • plnc8B
    • Sequence

    • MNNLNKFSTLGKSSLSQIEGGSVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH
    • Sequence Length

    • 55
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04470 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04470.
    • Formula

    • C283H443N75O80S
    • Absent Amino Acids

    • CD
    • Common Amino Acids

    • SK
    • Mass

    • 6208.14
    • PI

    • 10
    • Basic Residues

    • 10
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +8
    • Boman Index

    • -74.22
    • Hydrophobicity

    • -0.415
    • Aliphatic Index

    • 76.18
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 9970
    • Absorbance 280nm

    • 184.63
    • Polar Residues

    • 24

DRAMP04470

DRAMP04470 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Purification and genetic characterization of plantaricin NC8, a novel coculture-inducible two-peptide bacteriocin from Lactobacillus plantarum NC8.
    • Reference

    • Appl Environ Microbiol. 2003 Jan;69(1):383-389.
    • Author

    • Maldonado A, Ruiz-Barba JL, Jiménez-Díaz R.