General Information

    • DRAMP ID

    • DRAMP04471

    • Peptide Name

    • Durancin Q prepeptide (Prepeptide of durancin Q)

    • Source

    • Enterococcus durans

    • Family

    • Not found

    • Gene

    • duqQ

    • Sequence

    • MQTIKELNTMELQEIIGGENDHRMPYELNRPNNLSKGGAKCAAGILGAGLGAVGGGPGGFISAGISAVLGCM

    • Sequence Length

    • 72

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04471 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04471.

Physicochemical Information

    • Formula

    • C310H510N90O98S6

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • G

    • Mass

    • 7258.36

    • PI

    • 5.62

    • Basic Residues

    • 6

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 23

    • Net Charge

    • 0

    • Boman Index

    • -39.93

    • Hydrophobicity

    • 0.065

    • Aliphatic Index

    • 88.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 22.75

    • Polar Residues

    • 28

DRAMP04471

DRAMP04471 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Functional analysis and comparison of genes in the durM and the duqQ loci in durancin TW-49M and durancin Q biosynthesis and regulation.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hu C, Zendo T, Nakayama J, Sonomoto K.