General Information

    • DRAMP ID

    • DRAMP04472

    • Peptide Name

    • Pore-forming protein isoform B

    • Source

    • Entamoeba dispar

    • Family

    • Not found

    • Gene

    • Dp-B

    • Sequence

    • MRAIVFVLIFAIAFAATREGSILCNLCKDTVNLIENLLTVDGAQAVRQYIDNLCAKADGFLGTLCNKILSFGVDELVKLIENHVDPVVICEKIHAC

    • Sequence Length

    • 96

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04472 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C469H764N122O134S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • L

    • Mass

    • 10480.38

    • PI

    • 5.16

    • Basic Residues

    • 10

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 47

    • Net Charge

    • -1

    • Boman Index

    • -39.97

    • Hydrophobicity

    • 0.691

    • Aliphatic Index

    • 130

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 19.63

    • Polar Residues

    • 24

DRAMP04472

DRAMP04472 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Pore-forming peptides of Entamoeba dispar. Similarity and divergence to amoebapores in structure, expression and activity.

    • Reference

    • Eur J Biochem. 1999 Nov;265(3):1002-1007.

    • Author

    • Nickel R, Ott C, Dandekar T, Leippe M.