• DRAMP ID

    • DRAMP04472
    • Peptide Name

    • Pore-forming protein isoform B
    • Source

    • Entamoeba dispar
    • Family

    • Not found
    • Gene

    • Dp-B
    • Sequence

    • MRAIVFVLIFAIAFAATREGSILCNLCKDTVNLIENLLTVDGAQAVRQYIDNLCAKADGFLGTLCNKILSFGVDELVKLIENHVDPVVICEKIHAC
    • Sequence Length

    • 96
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04472 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04472.
    • Formula

    • C469H764N122O134S7
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • L
    • Mass

    • 10480.38
    • PI

    • 5.16
    • Basic Residues

    • 10
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 47
    • Net Charge

    • -1
    • Boman Index

    • -39.97
    • Hydrophobicity

    • 0.691
    • Aliphatic Index

    • 130
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 19.63
    • Polar Residues

    • 24

DRAMP04472

DRAMP04472 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Pore-forming peptides of Entamoeba dispar. Similarity and divergence to amoebapores in structure, expression and activity.
    • Reference

    • Eur J Biochem. 1999 Nov;265(3):1002-1007.
    • Author

    • Nickel R, Ott C, Dandekar T, Leippe M.