General Information

    • DRAMP ID

    • DRAMP04473

    • Peptide Name

    • Propionicin T1

    • Source

    • Propionibacterium thoenii

    • Family

    • Not found

    • Gene

    • pctA

    • Sequence

    • VPGGCTYTRSNRDVIGTCKTGSGQFRIRLDCNNAPDKTSVWAKPKVMVSVHCLVGQPRSISFETK

    • Sequence Length

    • 65

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04473 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C305H497N93O92S5

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • VGST

    • Mass

    • 7099.17

    • PI

    • 9.62

    • Basic Residues

    • 11

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +7

    • Boman Index

    • -129.04

    • Hydrophobicity

    • -0.386

    • Aliphatic Index

    • 64.31

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 113.13

    • Polar Residues

    • 26

DRAMP04473

DRAMP04473 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and genetic characterization of propionicin T1, a new bacteriocin from Propionibacterium thoenii.

    • Reference

    • Appl Environ Microbiol. 2000 Oct;66(10):4230-4236.

    • Author

    • Faye T, Langsrud T, Nes IF, Holo H.