General Information

    • DRAMP ID

    • DRAMP04474

    • Peptide Name

    • Defensin (Spodoptericin)

    • Source

    • Spodoptera frugiperda (Fall armyworm)

    • Family

    • Not found

    • Gene

    • Def

    • Sequence

    • VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI

    • Sequence Length

    • 36

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04474 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C165H249N43O58S6

    • Absent Amino Acids

    • MRW

    • Common Amino Acids

    • C

    • Mass

    • 3955.41

    • PI

    • 4.35

    • Basic Residues

    • 3

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 9

    • Net Charge

    • -3

    • Boman Index

    • -44.31

    • Hydrophobicity

    • -0.008

    • Aliphatic Index

    • 62.22

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 95.86

    • Polar Residues

    • 16

DRAMP04474

DRAMP04474 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and transcriptional profiles of three Spodoptera frugiperda genes encoding cysteine-rich peptides. A new class of defensin-like genes from lepidopteran insects?

    • Reference

    • Gene. 2003 Nov 13;319:43-53.

    • Author

    • Volkoff AN, Rocher J, d'Alençon E, Bouton M, Landais I, Quesada-Moraga E, Vey A, Fournier P, Mita K, Devauchelle G.