• DRAMP ID

    • DRAMP04474
    • Peptide Name

    • Defensin (Spodoptericin)
    • Source

    • Spodoptera frugiperda (Fall armyworm)
    • Family

    • Not found
    • Gene

    • Def
    • Sequence

    • VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
    • Sequence Length

    • 36
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04474 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04474.
    • Formula

    • C165H249N43O58S6
    • Absent Amino Acids

    • MRW
    • Common Amino Acids

    • C
    • Mass

    • 3955.41
    • PI

    • 4.35
    • Basic Residues

    • 3
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 9
    • Net Charge

    • -3
    • Boman Index

    • -44.31
    • Hydrophobicity

    • -0.008
    • Aliphatic Index

    • 62.22
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 95.86
    • Polar Residues

    • 16

DRAMP04474

DRAMP04474 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Characterization and transcriptional profiles of three Spodoptera frugiperda genes encoding cysteine-rich peptides. A new class of defensin-like genes from lepidopteran insects?
    • Reference

    • Gene. 2003 Nov 13;319:43-53.
    • Author

    • Volkoff AN, Rocher J, d'Alençon E, Bouton M, Landais I, Quesada-Moraga E, Vey A, Fournier P, Mita K, Devauchelle G.