General Information

    • DRAMP ID

    • DRAMP04475

    • Peptide Name

    • Putative defensin

    • Source

    • Lutzomyia longipalpis (Sand fly)

    • Family

    • Not found

    • Gene

    • DEF

    • Sequence

    • VTCDLLGPTGWGDALCAAHCISKGYRGGYCNAQKVCVCR

    • Sequence Length

    • 39

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04475 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C173H274N52O51S6

    • Absent Amino Acids

    • EFM

    • Common Amino Acids

    • CG

    • Mass

    • 4090.76

    • PI

    • 8.32

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -29.35

    • Hydrophobicity

    • 0.18

    • Aliphatic Index

    • 72.56

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 233.03

    • Polar Residues

    • 18

DRAMP04475

DRAMP04475 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The midgut transcriptome of Lutzomyia longipalpis: comparative analysis of cDNA libraries from sugar-fed, blood-fed, post-digested and Leishmania infantum chagasi-infected sand flies.

    • Reference

    • BMC Genomics. 2008 Jan 14;9:15.

    • Author

    • Jochim RC, Teixeira CR, Laughinghouse A, Mu J, Oliveira F, Gomes RB, Elnaiem DE, Valenzuela JG.