• DRAMP ID

    • DRAMP04475
    • Peptide Name

    • Putative defensin
    • Source

    • Lutzomyia longipalpis (Sand fly)
    • Family

    • Not found
    • Gene

    • DEF
    • Sequence

    • VTCDLLGPTGWGDALCAAHCISKGYRGGYCNAQKVCVCR
    • Sequence Length

    • 39
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04475 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04475.
    • Formula

    • C173H274N52O51S6
    • Absent Amino Acids

    • EFM
    • Common Amino Acids

    • CG
    • Mass

    • 4090.76
    • PI

    • 8.32
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +3
    • Boman Index

    • -29.35
    • Hydrophobicity

    • 0.18
    • Aliphatic Index

    • 72.56
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 233.03
    • Polar Residues

    • 18

DRAMP04475

DRAMP04475 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • The midgut transcriptome of Lutzomyia longipalpis: comparative analysis of cDNA libraries from sugar-fed, blood-fed, post-digested and Leishmania infantum chagasi-infected sand flies.
    • Reference

    • BMC Genomics. 2008 Jan 14;9:15.
    • Author

    • Jochim RC, Teixeira CR, Laughinghouse A, Mu J, Oliveira F, Gomes RB, Elnaiem DE, Valenzuela JG.