• DRAMP ID

    • DRAMP04476
    • Peptide Name

    • Beta defensin 1 (Beta-defensin-1)
    • Source

    • Equus caballus (Horse)
    • Family

    • Not found
    • Gene

    • defb1
    • Sequence

    • MRILHFLLAFLIVFLLPVPGFTAGIETSFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCRKK
    • Sequence Length

    • 64
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04476 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04476.
    • Formula

    • C313H504N80O79S7
    • Absent Amino Acids

    • DWY
    • Common Amino Acids

    • LG
    • Mass

    • 6876.35
    • PI

    • 9.34
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 24
    • Net Charge

    • +7
    • Boman Index

    • 0.18
    • Hydrophobicity

    • 0.62
    • Aliphatic Index

    • 97.5
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 5.95
    • Polar Residues

    • 23

DRAMP04476

DRAMP04476 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Equine beta-defensin-1: full-length cDNA sequence and tissue expression.
    • Reference

    • Vet Immunol Immunopathol. 2004 May;99(1-2):127-132.
    • Author

    • Davis EG, Sang Y, Blecha F.