General Information

    • DRAMP ID

    • DRAMP04476

    • Peptide Name

    • Beta defensin 1 (Beta-defensin-1)

    • Source

    • Equus caballus (Horse)

    • Family

    • Not found

    • Gene

    • defb1

    • Sequence

    • MRILHFLLAFLIVFLLPVPGFTAGIETSFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCRKK

    • Sequence Length

    • 64

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04476 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C313H504N80O79S7

    • Absent Amino Acids

    • DWY

    • Common Amino Acids

    • LG

    • Mass

    • 6876.35

    • PI

    • 9.34

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +7

    • Boman Index

    • 0.18

    • Hydrophobicity

    • 0.62

    • Aliphatic Index

    • 97.5

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 5.95

    • Polar Residues

    • 23

DRAMP04476

DRAMP04476 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Equine beta-defensin-1: full-length cDNA sequence and tissue expression.

    • Reference

    • Vet Immunol Immunopathol. 2004 May;99(1-2):127-132.

    • Author

    • Davis EG, Sang Y, Blecha F.