General Information

    • DRAMP ID

    • DRAMP04477

    • Peptide Name

    • Beta defensin-2

    • Source

    • Capra hircus (Goat)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MRLHHLLLALFFLVLSAGSGFTQGIINHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK

    • Sequence Length

    • 64

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04477 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04477.

Physicochemical Information

    • Formula

    • C312H512N102O76S8

    • Absent Amino Acids

    • DEW

    • Common Amino Acids

    • LRCG

    • Mass

    • 7164.62

    • PI

    • 10.56

    • Basic Residues

    • 15

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +15

    • Boman Index

    • -96.24

    • Hydrophobicity

    • -0.066

    • Aliphatic Index

    • 80.78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 29.6

    • Polar Residues

    • 21

DRAMP04477

DRAMP04477 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Differential expression of caprine beta-defensins in digestive and respiratory tissues.

    • Reference

    • Infect Immun. 1999 Nov;67(11):6221-6224.

    • Author

    • Zhao C, Nguyen T, Liu L, Shamova O, Brogden K, Lehrer RI.