General Information

    • DRAMP ID

    • DRAMP04478

    • Peptide Name

    • Defensin TY 1

    • Source

    • Tabanus yao (Horsefly)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MNFLKVFLVICAILATVWASPLGASEDREHHPEERAPCAQSEKDRCVAFCLTNGFSGGFCTSRGCKCEE

    • Sequence Length

    • 69

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04478 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04478.

Physicochemical Information

    • Formula

    • C327H508N92O99S8

    • Absent Amino Acids

    • Y

    • Common Amino Acids

    • ACE

    • Mass

    • 7568.67

    • PI

    • 5.55

    • Basic Residues

    • 9

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 24

    • Net Charge

    • 0

    • Boman Index

    • -97.78

    • Hydrophobicity

    • -0.016

    • Aliphatic Index

    • 66.52

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 86.4

    • Polar Residues

    • 22

DRAMP04478

DRAMP04478 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of defensin in horsefly (Tabanus Yao).

    • Reference

    • Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Xu X, Ma D, Wu J, Lai R.