General Information

    • DRAMP ID

    • DRAMP04479

    • Peptide Name

    • Defensin like 3 (Predicted)

    • Source

    • Equus caballus (Horse)

    • Family

    • Not found

    • Gene

    • defl3

    • Sequence

    • MRLLFLLFLLLVCLIQMASGHEKTGRKHECQNMGGACKHQKTHGCAILPADCKSRNKHCCRV

    • Sequence Length

    • 62

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04479 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C298H497N95O78S10

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • L

    • Mass

    • 6979.41

    • PI

    • 9.36

    • Basic Residues

    • 15

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +12

    • Boman Index

    • -84.35

    • Hydrophobicity

    • -0.071

    • Aliphatic Index

    • 85

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 6.15

    • Polar Residues

    • 18

DRAMP04479

DRAMP04479 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Sequence analysis of a 212 kb defensin gene cluster on ECA 27q17.

    • Reference

    • Gene. 2006 Jul 19;376(2):192-198.

    • Author

    • Looft C, Paul S, Philipp U, Regenhard P, Kuiper H, Distl O, Chowdhary BP, Leeb T.