• DRAMP ID

    • DRAMP04479
    • Peptide Name

    • Defensin like 3 (Predicted)
    • Source

    • Equus caballus (Horse)
    • Family

    • Not found
    • Gene

    • defl3
    • Sequence

    • MRLLFLLFLLLVCLIQMASGHEKTGRKHECQNMGGACKHQKTHGCAILPADCKSRNKHCCRV
    • Sequence Length

    • 62
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04479 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04479.
    • Formula

    • C298H497N95O78S10
    • Absent Amino Acids

    • WY
    • Common Amino Acids

    • L
    • Mass

    • 6979.41
    • PI

    • 9.36
    • Basic Residues

    • 15
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 19
    • Net Charge

    • +12
    • Boman Index

    • -84.35
    • Hydrophobicity

    • -0.071
    • Aliphatic Index

    • 85
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 6.15
    • Polar Residues

    • 18

DRAMP04479

DRAMP04479 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Sequence analysis of a 212 kb defensin gene cluster on ECA 27q17.
    • Reference

    • Gene. 2006 Jul 19;376(2):192-198.
    • Author

    • Looft C, Paul S, Philipp U, Regenhard P, Kuiper H, Distl O, Chowdhary BP, Leeb T.