• DRAMP ID

    • DRAMP04480
    • Peptide Name

    • Alpha defensin
    • Source

    • Saguinus labiatus (Red-chested mustached tamarin)
    • Family

    • Not found
    • Gene

    • DEFA1
    • Sequence

    • MRTFALLAATVLLVILQAQAEPVQARADEVAAQEQPGGHAQEASVSFVWDEGAAGQVSGERGQHAKLQSLEGQTGNGLWNRVSMVHVT
    • Sequence Length

    • 88
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04480 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04480.
    • Formula

    • C404H643N121O128S2
    • Absent Amino Acids

    • CY
    • Common Amino Acids

    • A
    • Mass

    • 9307.4
    • PI

    • 5.13
    • Basic Residues

    • 8
    • Acidic Residues

    • 9
    • Hydrophobic Residues

    • 37
    • Net Charge

    • -1
    • Boman Index

    • -106.48
    • Hydrophobicity

    • -0.101
    • Aliphatic Index

    • 88.75
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 126.44
    • Polar Residues

    • 20

DRAMP04480

DRAMP04480 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Evolution of primate theta-defensins: a serpentine path to a sweet tooth.
    • Reference

    • ptides. 2003 Nov;24(11):1647-1654.
    • Author

    • Nguyen TX, Cole AM, Lehrer RI.