General Information

    • DRAMP ID

    • DRAMP04481

    • Peptide Name

    • Circularin A

    • Source

    • Geobacillus kaustophilus (strain HTA426)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MSLLALVAGTLGVSQSIATTVVSIVLTGSTLISIILGITAILSGGVDAILEIGWSAFVATVKKIVAERGKAAAIAW

    • Sequence Length

    • 76

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04481 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04481.

Physicochemical Information

    • Formula

    • C348H589N85O99S

    • Absent Amino Acids

    • CHNPY

    • Common Amino Acids

    • AI

    • Mass

    • 7580.07

    • PI

    • 8.25

    • Basic Residues

    • 4

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 44

    • Net Charge

    • +1

    • Boman Index

    • 69.35

    • Hydrophobicity

    • 1.333

    • Aliphatic Index

    • 152.76

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11000

    • Absorbance 280nm

    • 146.67

    • Polar Residues

    • 23

DRAMP04481

DRAMP04481 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Thermoadaptation trait revealed by the genome sequence of thermophilic Geobacillus kaustophilus.

    • Reference

    • Nucleic Acids Res. 2004 Dec 1;32(21):6292-303.

    • Author

    • Takami H, Takaki Y, Chee GJ, Nishi S, Shimamura S, Suzuki H, Matsui S, Uchiyama I.