General Information

    • DRAMP ID

    • DRAMP04482

    • Peptide Name

    • Antimicrobial-like peptide PP-1 (Predicted)

    • Source

    • Pheretima tschiliensis

    • Family

    • Not found

    • Gene

    • Pp-1

    • Sequence

    • MYSKYERQKDKRPYSERKDQYTGPQFLYPPDRIPPSKAIKWNEEGLPMYEVLPDGAGAKTAVEAAAE

    • Sequence Length

    • 67

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04482 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04482.

Physicochemical Information

    • Formula

    • C346H529N91O105S2

    • Absent Amino Acids

    • CH

    • Common Amino Acids

    • PAEK

    • Mass

    • 7707.67

    • PI

    • 6.22

    • Basic Residues

    • 11

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 16

    • Net Charge

    • 0

    • Boman Index

    • -161.4

    • Hydrophobicity

    • -1.145

    • Aliphatic Index

    • 48.21

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14440

    • Absorbance 280nm

    • 218.79

    • Polar Residues

    • 16

DRAMP04482

DRAMP04482 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • cDNA cloning and molecular characterization of a new antimicrobial-like peptide from Pheretima tschiliensis.

    • Reference

    • Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases

    • Author

    • Wang X, Wang X.X.