• DRAMP ID

    • DRAMP04482
    • Peptide Name

    • Antimicrobial-like peptide PP-1 (Predicted)
    • Source

    • Pheretima tschiliensis
    • Family

    • Not found
    • Gene

    • Pp-1
    • Sequence

    • MYSKYERQKDKRPYSERKDQYTGPQFLYPPDRIPPSKAIKWNEEGLPMYEVLPDGAGAKTAVEAAAE
    • Sequence Length

    • 67
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04482 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04482.
    • Formula

    • C346H529N91O105S2
    • Absent Amino Acids

    • CH
    • Common Amino Acids

    • PAEK
    • Mass

    • 7707.67
    • PI

    • 6.22
    • Basic Residues

    • 11
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 16
    • Net Charge

    • 0
    • Boman Index

    • -161.4
    • Hydrophobicity

    • -1.145
    • Aliphatic Index

    • 48.21
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14440
    • Absorbance 280nm

    • 218.79
    • Polar Residues

    • 16

DRAMP04482

DRAMP04482 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • cDNA cloning and molecular characterization of a new antimicrobial-like peptide from Pheretima tschiliensis.
    • Reference

    • Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    • Author

    • Wang X, Wang X.X.