• DRAMP ID

    • DRAMP04483
    • Peptide Name

    • Acidocin LF221B (Gassericin K7 B)
    • Source

    • Lactobacillus gasseri
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN
    • Sequence Length

    • 48
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04483 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04483.
    • Formula

    • C212H320N62O59S3
    • Absent Amino Acids

    • DEHQ
    • Common Amino Acids

    • G
    • Mass

    • 4777.43
    • PI

    • 9.7
    • Basic Residues

    • 4
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +4
    • Boman Index

    • -7.25
    • Hydrophobicity

    • 0.133
    • Aliphatic Index

    • 61.25
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19605
    • Absorbance 280nm

    • 417.13
    • Polar Residues

    • 24

DRAMP04483

DRAMP04483 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • DNA analysis of the genes encoding acidocin LF221 A and acidocin LF221 B, two bacteriocins produced by Lactobacillus gasseri LF221.
    • Reference

    • Appl Microbiol Biotechnol. 2004 Feb;63(6):705-714.
    • Author

    • Majhenic AC, Venema K, Allison GE, Matijasić BB, Rogelj I, Klaenhammer TR.