General Information

    • DRAMP ID

    • DRAMP04483

    • Peptide Name

    • Acidocin LF221B (Gassericin K7 B)

    • Source

    • Lactobacillus gasseri

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN

    • Sequence Length

    • 48

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04483 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C212H320N62O59S3

    • Absent Amino Acids

    • DEHQ

    • Common Amino Acids

    • G

    • Mass

    • 4777.43

    • PI

    • 9.7

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +4

    • Boman Index

    • -7.25

    • Hydrophobicity

    • 0.133

    • Aliphatic Index

    • 61.25

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19605

    • Absorbance 280nm

    • 417.13

    • Polar Residues

    • 24

DRAMP04483

DRAMP04483 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • DNA analysis of the genes encoding acidocin LF221 A and acidocin LF221 B, two bacteriocins produced by Lactobacillus gasseri LF221.

    • Reference

    • Appl Microbiol Biotechnol. 2004 Feb;63(6):705-714.

    • Author

    • Majhenic AC, Venema K, Allison GE, Matijasić BB, Rogelj I, Klaenhammer TR.