General Information

    • DRAMP ID

    • DRAMP04484

    • Peptide Name

    • Crustin-like protein fc-2 (Predicted)

    • Source

    • Fenneropenaeus chinensis (Fleshy prawn) (Penaeus chinensis)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QNKDDTRFLGGVPGVGGGFVPGVPGHGGVAPVGGGLVPGGGGLIPGGGFECNYCRTRYGYVCCSDKCCYDVCLNDTVCKPIVLGSEG

    • Sequence Length

    • 87

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04484 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C375H579N105O115S8

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • G

    • Mass

    • 8654.84

    • PI

    • 5.57

    • Basic Residues

    • 7

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 22

    • Net Charge

    • 0

    • Boman Index

    • -42.33

    • Hydrophobicity

    • 0.094

    • Aliphatic Index

    • 69.2

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6460

    • Absorbance 280nm

    • 75.12

    • Polar Residues

    • 43

DRAMP04484

DRAMP04484 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cloning and recombinant expression of a crustin-like gene from Chinese shrimp, Fenneropenaeus chinensis.

    • Reference

    • J Biotechnol. 2007 Jan 20;127(4):605-614.

    • Author

    • Zhang J, Li F, Wang Z, Xiang J.