• DRAMP ID

    • DRAMP04486
    • Peptide Name

    • Cold-regulated LTCOR12
    • Source

    • Lavatera thuringiaca
    • Family

    • Not found
    • Gene

    • LtCor12
    • Sequence

    • SFPKKIDCGGACAARCQLSSRPHLCKRACGTCCARSRCVPPGTAGNQEMCPCYASLTTHGGKRKCP
    • Sequence Length

    • 66
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04486 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04486.
    • Formula

    • C282H468N96O84S12
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • C
    • Mass

    • 6932.13
    • PI

    • 9.26
    • Basic Residues

    • 13
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +11
    • Boman Index

    • -124.88
    • Hydrophobicity

    • -0.394
    • Aliphatic Index

    • 38.64
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2115
    • Absorbance 280nm

    • 32.54
    • Polar Residues

    • 29

DRAMP04486

DRAMP04486 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Cloning and characterization of low temperature-regulated genes from Lavatera thuringiaca.
    • Reference

    • Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    • Author

    • Vazquez-Tello A.