General Information

    • DRAMP ID

    • DRAMP04486

    • Peptide Name

    • Cold-regulated LTCOR12

    • Source

    • Lavatera thuringiaca

    • Family

    • Not found

    • Gene

    • LtCor12

    • Sequence

    • SFPKKIDCGGACAARCQLSSRPHLCKRACGTCCARSRCVPPGTAGNQEMCPCYASLTTHGGKRKCP

    • Sequence Length

    • 66

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04486 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C282H468N96O84S12

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • C

    • Mass

    • 6932.13

    • PI

    • 9.26

    • Basic Residues

    • 13

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +11

    • Boman Index

    • -124.88

    • Hydrophobicity

    • -0.394

    • Aliphatic Index

    • 38.64

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2115

    • Absorbance 280nm

    • 32.54

    • Polar Residues

    • 29

DRAMP04486

DRAMP04486 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of low temperature-regulated genes from Lavatera thuringiaca.

    • Reference

    • Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases

    • Author

    • Vazquez-Tello A.