• DRAMP ID

    • DRAMP04487
    • Peptide Name

    • LTCOR11
    • Source

    • Lavatera thuringiaca
    • Family

    • Not found
    • Gene

    • LtCor11
    • Sequence

    • SSPKKIDCGGACAARCQLSSRPHLCKRACGTCCARCACVPPGTAGNQEMCPKCYASLTTHGGKRKCP
    • Sequence Length

    • 67
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04487 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04487.
    • Formula

    • C279H469N95O85S13
    • Absent Amino Acids

    • FW
    • Common Amino Acids

    • C
    • Mass

    • 6931.16
    • PI

    • 9.16
    • Basic Residues

    • 13
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +11
    • Boman Index

    • -115.4
    • Hydrophobicity

    • -0.357
    • Aliphatic Index

    • 39.55
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2240
    • Absorbance 280nm

    • 33.94
    • Polar Residues

    • 30

DRAMP04487

DRAMP04487 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • LtCor11, a low-temperature-regulated gene from Lavatera thuringiaca homologous to the gibberellin-regulated GAS1 gene from Arabidopsis thaliana.
    • Reference

    • Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    • Author

    • Vazquez-Tello A, Uozumi T.