General Information

    • DRAMP ID

    • DRAMP04488

    • Peptide Name

    • Antimicrobial peptide 2 (Antimicrobial peptide 4)

    • Source

    • Pinus sylvestris (Scots pine)

    • Family

    • Not found

    • Gene

    • AMP4

    • Sequence

    • SYFTAWAGPGCNNHAARYSKCGCSNIGNNVHGGYEFMYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSSFGWKSFFIQC

    • Sequence Length

    • 79

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04488 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C372H535N107O115S7

    • Absent Amino Acids

    • L

    • Common Amino Acids

    • AGSN

    • Mass

    • 8570.41

    • PI

    • 8.6

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +5

    • Boman Index

    • -114.46

    • Hydrophobicity

    • -0.4

    • Aliphatic Index

    • 32.28

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18825

    • Absorbance 280nm

    • 241.35

    • Polar Residues

    • 41

DRAMP04488

DRAMP04488 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation of a novel antimicrobial peptide gene (Sp-AMP) homologue from Pinus sylvestris (Scots pine) following infection with the root rot fungus Heterobasidion annosum.

    • Reference

    • FEMS Microbiol Lett. 2003 Nov 7;228(1):27-31.

    • Author

    • Asiegbu FO, Choi W, Li G, Nahalkova J, Dean RA.