• DRAMP ID

    • DRAMP04488
    • Peptide Name

    • Antimicrobial peptide 2 (Antimicrobial peptide 4)
    • Source

    • Pinus sylvestris (Scots pine)
    • Family

    • Not found
    • Gene

    • AMP4
    • Sequence

    • SYFTAWAGPGCNNHAARYSKCGCSNIGNNVHGGYEFMYQGQTAAAYNTDNCKGVAQTRFSSSVNQACSSFGWKSFFIQC
    • Sequence Length

    • 79
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04488 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04488.
    • Formula

    • C372H535N107O115S7
    • Absent Amino Acids

    • L
    • Common Amino Acids

    • AGSN
    • Mass

    • 8570.41
    • PI

    • 8.6
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 22
    • Net Charge

    • +5
    • Boman Index

    • -114.46
    • Hydrophobicity

    • -0.4
    • Aliphatic Index

    • 32.28
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18825
    • Absorbance 280nm

    • 241.35
    • Polar Residues

    • 41

DRAMP04488

DRAMP04488 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation of a novel antimicrobial peptide gene (Sp-AMP) homologue from Pinus sylvestris (Scots pine) following infection with the root rot fungus Heterobasidion annosum.
    • Reference

    • FEMS Microbiol Lett. 2003 Nov 7;228(1):27-31.
    • Author

    • Asiegbu FO, Choi W, Li G, Nahalkova J, Dean RA.