General Information

    • DRAMP ID

    • DRAMP04489

    • Peptide Name

    • MAP34-A protein (MAP34-B protein)

    • Source

    • Capra hircus (Goat)

    • Family

    • Not found

    • Gene

    • map34-A

    • Sequence

    • SYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDQGARKPVSFRVKETVCPRTSQQPVEQCD

    • Sequence Length

    • 66

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04489 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C324H515N97O109S2

    • Absent Amino Acids

    • HIMW

    • Common Amino Acids

    • ER

    • Mass

    • 7577.36

    • PI

    • 4.68

    • Basic Residues

    • 9

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 19

    • Net Charge

    • -4

    • Boman Index

    • -210

    • Hydrophobicity

    • -0.976

    • Aliphatic Index

    • 65

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3105

    • Absorbance 280nm

    • 47.77

    • Polar Residues

    • 13

DRAMP04489

DRAMP04489 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • cDNA cloning of goat cathelin related peptides.

    • Reference

    • Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases

    • Author

    • Zhao C, Nguyen T, Brogden K, Lehrer R.