• DRAMP ID

    • DRAMP04489
    • Peptide Name

    • MAP34-A protein (MAP34-B protein)
    • Source

    • Capra hircus (Goat)
    • Family

    • Not found
    • Gene

    • map34-A
    • Sequence

    • SYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDQGARKPVSFRVKETVCPRTSQQPVEQCD
    • Sequence Length

    • 66
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04489 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04489.
    • Formula

    • C324H515N97O109S2
    • Absent Amino Acids

    • HIMW
    • Common Amino Acids

    • ER
    • Mass

    • 7577.36
    • PI

    • 4.68
    • Basic Residues

    • 9
    • Acidic Residues

    • 13
    • Hydrophobic Residues

    • 19
    • Net Charge

    • -4
    • Boman Index

    • -210
    • Hydrophobicity

    • -0.976
    • Aliphatic Index

    • 65
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3105
    • Absorbance 280nm

    • 47.77
    • Polar Residues

    • 13

DRAMP04489

DRAMP04489 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • cDNA cloning of goat cathelin related peptides.
    • Reference

    • Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
    • Author

    • Zhao C, Nguyen T, Brogden K, Lehrer R.