• DRAMP ID

    • DRAMP04490
    • Peptide Name

    • Myeloid antimicrobial peptide
    • Source

    • Ovis aries (Sheep)
    • Family

    • Not found
    • Gene

    • Map-34
    • Sequence

    • SYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDRGARKPVSFKVKETVCPRTSQQPVEQCD
    • Sequence Length

    • 66
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP04490 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP04490.
    • Formula

    • C325H519N97O108S2
    • Absent Amino Acids

    • HIMW
    • Common Amino Acids

    • ER
    • Mass

    • 7577.4
    • PI

    • 4.85
    • Basic Residues

    • 10
    • Acidic Residues

    • 13
    • Hydrophobic Residues

    • 19
    • Net Charge

    • -3
    • Boman Index

    • -210.01
    • Hydrophobicity

    • -0.982
    • Aliphatic Index

    • 65
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3105
    • Absorbance 280nm

    • 47.77
    • Polar Residues

    • 13

DRAMP04490

DRAMP04490 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Molecular analysis of the sheep cathelin family reveals a novel antimicrobial peptide.
    • Reference

    • FEBS Lett. 1995 Dec 27;377(3):519-522.
    • Author

    • Mahoney MM, Lee AY, Brezinski-Caliguri DJ, Huttner KM.