General Information

    • DRAMP ID

    • DRAMP04492

    • Peptide Name

    • Persulcatusin

    • Source

    • Ixodes persulcatus (Taiga tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYSR

    • Sequence Length

    • 38

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04492 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C176H269N61O48S6

    • Absent Amino Acids

    • DEMVW

    • Common Amino Acids

    • G

    • Mass

    • 4199.81

    • PI

    • 9.43

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +8

    • Boman Index

    • -82.75

    • Hydrophobicity

    • -0.474

    • Aliphatic Index

    • 25.79

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 90.68

    • Polar Residues

    • 20

DRAMP04492

DRAMP04492 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of antimicrobial peptide, defensin, in the taiga tick, Ixodes persulcatus.

    • Reference

    • Insect Mol. Biol. 2009, 18:531-539.

    • Author

    • Saito Y, Konnai S, Yamada S, Imamura S, Nishikado H, Ito T, Onuma M, Ohashi K.