General Information

    • DRAMP ID

    • DRAMP04493

    • Peptide Name

    • Amercin

    • Source

    • Amblyomma americanum (Lone star tick)

    • Family

    • Not found

    • Gene

    • amn

    • Sequence

    • GFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN

    • Sequence Length

    • 37

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP04493 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP04493.

Physicochemical Information

    • Formula

    • C172H250N52O51S6

    • Absent Amino Acids

    • ADEMVW

    • Common Amino Acids

    • G

    • Mass

    • 4054.55

    • PI

    • 8.66

    • Basic Residues

    • 5

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +5

    • Boman Index

    • -54.36

    • Hydrophobicity

    • -0.389

    • Aliphatic Index

    • 21.08

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 134.58

    • Polar Residues

    • 24

DRAMP04493

DRAMP04493 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Tissue and life-stage distribution of a defensin gene in the Lone Star tick, Amblyomma americanum.

    • Reference

    • Med Vet Entomol. 2007 Jun;21(2):141-147.

    • Author

    • Todd SM, Sonenshine DE, Hynes WL.